[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81422.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:65 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->55 PF05317 * Thermopsin 0.00084 23.9 46/266  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81422.1 GT:GENE AAQ81422.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(57911..58108) GB:FROM 57911 GB:TO 58108 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81422.1 GB:DB_XREF GI:34732884 LENGTH 65 SQ:AASEQ MAANKWQKPGPVMNRVFEEAFIGLLGDGCENIIVHSFKDDGDEVIVNFELVVGGKLIINQTRLIA GT:EXON 1|1-65:0| HM:PFM:NREP 1 HM:PFM:REP 10->55|PF05317|0.00084|23.9|46/266|Thermopsin| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED ccccccccccHHHHHHHHHHHHHHHHccccEEEEEEEcccccEEEEEEEEEEEEEEEEEEEEEcc //