[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81428.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
c.47.1
:75 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   5->51 1m7tA PDBj 1e-07 40.4 %
:RPS:PDB   1->73 2b5eA PDBj 1e-09 20.5 %
:RPS:SCOP  5->73 1iloA  c.47.1.1 * 2e-08 14.9 %
:HMM:SCOP  2->73 1j08A1 c.47.1.2 * 1.3e-10 42.3 %
:RPS:PFM   5->61 PF00085 * Thioredoxin 1e-07 43.9 %
:HMM:PFM   4->54 PF00085 * Thioredoxin 1.6e-11 29.4 51/104  
:BLT:SWISS 5->73 THIO_HELPY 1e-08 47.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81428.1 GT:GENE AAQ81428.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(60432..60659) GB:FROM 60432 GB:TO 60659 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE similar to sp P06544, P12243 Thioredoxin GB:PROTEIN_ID AAQ81428.1 GB:DB_XREF GI:34732890 LENGTH 75 SQ:AASEQ MIYLFGAEWCANCKMVKPMLANVEYTYVDVDTDEGVELTAKHHIRSLPTLVNTSTLDRFTGVPRNVANLKEKLGI GT:EXON 1|1-75:0| BL:SWS:NREP 1 BL:SWS:REP 5->73|THIO_HELPY|1e-08|47.1|68/106| BL:PDB:NREP 1 BL:PDB:REP 5->51|1m7tA|1e-07|40.4|47/107| RP:PDB:NREP 1 RP:PDB:REP 1->73|2b5eA|1e-09|20.5|73/483| RP:PFM:NREP 1 RP:PFM:REP 5->61|PF00085|1e-07|43.9|57/103|Thioredoxin| HM:PFM:NREP 1 HM:PFM:REP 4->54|PF00085|1.6e-11|29.4|51/104|Thioredoxin| GO:PFM:NREP 1 GO:PFM GO:0045454|"GO:cell redox homeostasis"|PF00085|IPR013766| RP:SCP:NREP 1 RP:SCP:REP 5->73|1iloA|2e-08|14.9|67/77|c.47.1.1| HM:SCP:REP 2->73|1j08A1|1.3e-10|42.3|71/118|c.47.1.2|1/1|Thioredoxin-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 98.7 SQ:SECSTR EEEEEEcTTcHHHHHHHHHHHHHccccEEEEEEGGGccccccccccccEEEcTTcccccccccccHHHHHHHHH# PSIPRED cEEEEEcccccHHHcccHHHHHHHHHHHHHcHHHcHHHHHHcccccccEEEccEEEEEEEcccccHHHHHHHHcc //