[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81430.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  187/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
a.25.1
:323 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   90->282 2r2fB PDBj 7e-07 23.9 %
:RPS:PDB   8->286 2aniA PDBj 2e-30 21.3 %
:RPS:SCOP  9->289 1kgnA  a.25.1.2 * 1e-38 21.0 %
:HMM:SCOP  1->294 1uzrA_ a.25.1.2 * 4.4e-55 25.3 %
:RPS:PFM   10->285 PF00268 * Ribonuc_red_sm 2e-15 28.8 %
:HMM:PFM   9->283 PF00268 * Ribonuc_red_sm 2.5e-20 21.3 258/281  
:BLT:SWISS 12->310 RIR2_IIV3 2e-23 30.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81430.1 GT:GENE AAQ81430.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(62644..63615) GB:FROM 62644 GB:TO 63615 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE matches Pfam ribonuc_red_sm ribonucleotide reductase, small chain E=1.5e-08; similar to sp O83092, P17424 Ribonucleoside-diphosphate reductase 2 beta chain GB:PROTEIN_ID AAQ81430.1 GB:DB_XREF GI:34732892 LENGTH 323 SQ:AASEQ MYQDQEGWIIRYPEFAALADEQMHAFWPWDEPVVDNDAQDLRTKLTPGELNGITTVLKLFTIYERKVGEDYWTGRIARTFGRPEINRMATLFSAVEGNSHAPFYNKVNEVLYLDDEAFYTSWKESEELSRRIQFVGKSVSDPDDAKSFAAFTFIEGAVLYSSFAFLKHFQAQECGKDLMRNICRGVDLSVADEHHHSIGGAMLFRTLCREMMEHHKVDVREKLKDDIIAMAHQVYDHESGIIDLVFAEPIDGITADELRIFVKSRINLCLENLGYDPIFEIESNPIASWFYRTINAKKFHDFFTGSGSEYNINWDRAGFSDCW GT:EXON 1|1-323:0| BL:SWS:NREP 1 BL:SWS:REP 12->310|RIR2_IIV3|2e-23|30.2|288/376| BL:PDB:NREP 1 BL:PDB:REP 90->282|2r2fB|7e-07|23.9|180/285| RP:PDB:NREP 1 RP:PDB:REP 8->286|2aniA|2e-30|21.3|268/317| RP:PFM:NREP 1 RP:PFM:REP 10->285|PF00268|2e-15|28.8|260/277|Ribonuc_red_sm| HM:PFM:NREP 1 HM:PFM:REP 9->283|PF00268|2.5e-20|21.3|258/281|Ribonuc_red_sm| GO:PFM:NREP 3 GO:PFM GO:0004748|"GO:ribonucleoside-diphosphate reductase activity"|PF00268|IPR000358| GO:PFM GO:0009186|"GO:deoxyribonucleoside diphosphate metabolic process"|PF00268|IPR000358| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00268|IPR000358| RP:SCP:NREP 1 RP:SCP:REP 9->289|1kgnA|1e-38|21.0|267/296|a.25.1.2| HM:SCP:REP 1->294|1uzrA_|4.4e-55|25.3|277/282|a.25.1.2|1/1|Ferritin-like| OP:NHOMO 191 OP:NHOMOORG 191 OP:PATTERN ---------------------------1--11------------------------------------ -----1-1111--1------------------------11----1-1-1---11111----------------------------11------------111---1--1------------------------------------1--------------------------------------1------------------------1---------------------11---------------------------1--------------1------------------------------------1-11---111-------------1-------111--------------------------1---1111------------------11111111111-----------1-111111-111----111--------1-1111111111111-1-1111111111111111111111111111111-111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----1111111111-1111111111111111111111----1111--111111-1--1-1111111------------------------------1-111-1------1--------------------------------111111111------------1--------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 306 STR:RPRED 94.7 SQ:SECSTR ccTTGGGcccccHHHHHHHHHHHHTcccGGGcccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccHHHHHTHHHHcHHHHHHHHHHHHHHTGGGcTTHHHHHTTcccccTHHHHHHHHHHHHTTTccTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcGGHHHHGccHHHHHHHHHHHHHHHHHHHHHHHHHcccccTTccHHHHHHHHHHHHHHHHHHTTccccccccTccccHHHHHHTccc###ccccTTTTc############## DISOP:02AL 1-1,317-318,321-324| PSIPRED ccccccccccccHHHHHHHHHHHHccccHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHccccccccccccccccEEEEEcccccccc //