[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81431.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:153 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:HMM:PFM   85->141 PF02166 * Androgen_recep 0.00022 32.1 56/423  
:BLT:SWISS 19->90 GYRA_AERSA 7e-04 34.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81431.1 GT:GENE AAQ81431.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(63652..64113) GB:FROM 63652 GB:TO 64113 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81431.1 GB:DB_XREF GI:34732893 LENGTH 153 SQ:AASEQ MNNVVCQCCNQIKPKIVTIKDDNFFESVTVVNAHDTIATTVKLHKLSYDQLPGGALIVADRDIITSIRRAGGNKPRMLDAMSFCRDKMHFELLGRPPVIIFNTQTPLTDIRIALYSKTGFSKSTEFTAYYVRYKESTMRNLVNRFKNIFKNTI GT:EXON 1|1-153:0| BL:SWS:NREP 1 BL:SWS:REP 19->90|GYRA_AERSA|7e-04|34.7|72/922| HM:PFM:NREP 1 HM:PFM:REP 85->141|PF02166|0.00022|32.1|56/423|Androgen_recep| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 67 STR:RPRED 43.8 SQ:SECSTR #####################################################################################HHTTcccccTTcEEE#EccccTTcEEEEEEEccTTcccHHHHHHHHHHTHHHHHHHHcccccccHHHH DISOP:02AL 1-1,153-154| PSIPRED cccHHHHHHcccccEEEEEEccccEEEEEEEEccccEEEEEEEEEcccccccccEEEEEcHHHHHHHHHccccccHHHHHHHHHHHHHHHEEcccccEEEEcccccccEEEEEEEEcccccccccEEEEEEEEEHHHHHHHHHHHHHHHHHcc //