[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81432.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:57 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->48 PF09888 * DUF2115 0.00067 31.2 32/163  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81432.1 GT:GENE AAQ81432.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(64159..64332) GB:FROM 64159 GB:TO 64332 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81432.1 GB:DB_XREF GI:34732894 LENGTH 57 SQ:AASEQ MSNVTHLVNFGHGELAVKKVASYFHVLKSADPMLPVGTEFPIKDTVTLDADVIQLNA GT:EXON 1|1-57:0| HM:PFM:NREP 1 HM:PFM:REP 17->48|PF09888|0.00067|31.2|32/163|DUF2115| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEEEEcc //