[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81433.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:151 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   77->108 PF10955 * DUF2757 2.3e-05 31.2 32/76  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81433.1 GT:GENE AAQ81433.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(64418..64873) GB:FROM 64418 GB:TO 64873 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81433.1 GB:DB_XREF GI:34732895 LENGTH 151 SQ:AASEQ MSIVKERFFNYKTFFIDAINRSYANKPSGCIQEMSQSKSSFLREHRTIHLNLGRMTGKTTGLLHLANEVSAQGGARIITMNSANKRHVQDMVSYQWRGDIRISTISELTDRCPKVKFLMIDESEYTLTSRHQRQEIYDWAGTHGVEFVIMT GT:EXON 1|1-151:0| HM:PFM:NREP 1 HM:PFM:REP 77->108|PF10955|2.3e-05|31.2|32/76|DUF2757| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,32-40| PSIPRED ccHHHHHHccccEEEEEEHHHHHcccccHHHHHHHHHHHHHHHcccEEEEEEEEcccccEEEEEEHHHHcccccEEEEEEEcccHHHHHHHHcEEEcccEEEEEHHHHHcccccEEEEEEEcccccHHHHHHHHHHHHHcccccEEEEEEc //