[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81434.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:67 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   20->58 PF00823 * PPE 0.00053 28.2 39/159  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81434.1 GT:GENE AAQ81434.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(64938..65141) GB:FROM 64938 GB:TO 65141 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81434.1 GB:DB_XREF GI:34732896 LENGTH 67 SQ:AASEQ MSHIDRMQVELRDLTDKIVALDSFIGGSPIFPQLEFAQQELMVQQLDAMKAYQLILSARIDLAIETE GT:EXON 1|1-67:0| HM:PFM:NREP 1 HM:PFM:REP 20->58|PF00823|0.00053|28.2|39/159|PPE| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,66-68| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEcc //