[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81435.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:69 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   22->60 PF05454 * DAG1 0.00073 23.1 39/290  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81435.1 GT:GENE AAQ81435.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(65152..65361) GB:FROM 65152 GB:TO 65361 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81435.1 GB:DB_XREF GI:34732897 LENGTH 69 SQ:AASEQ MAMMHEKSHAREGRGGANGNNANWYNSPLWDSTGPKKKVGVVKEQIPEEELTEEQKLKRKQQALLRALY GT:EXON 1|1-69:0| SEG 10->23|aregrggangnnan| SEG 43->62|keqipeeelteeqklkrkqq| HM:PFM:NREP 1 HM:PFM:REP 22->60|PF05454|0.00073|23.1|39/290|DAG1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-20,48-61| PSIPRED cccHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHc //