[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81439.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:79 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   57->74 PF00880 * Nebulin 2.4e-05 50.0 18/29  
:HMM:PFM   27->52 PF03108 * MuDR 0.00014 30.8 26/67  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81439.1 GT:GENE AAQ81439.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(68581..68820) GB:FROM 68581 GB:TO 68820 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81439.1 GB:DB_XREF GI:34732901 LENGTH 79 SQ:AASEQ MLRSTDIVHTKFDENELRALTKSRIKSFKTACYKSMGTRFGGWCCDDKCEWVERERDTPEYAMAKANMDLINKVYSEMS GT:EXON 1|1-79:0| HM:PFM:NREP 2 HM:PFM:REP 57->74|PF00880|2.4e-05|50.0|18/29|Nebulin| HM:PFM:REP 27->52|PF03108|0.00014|30.8|26/67|MuDR| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,78-80| PSIPRED ccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcc //