[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81440.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
:184 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   93->162 PF10544 * T5orf172 2.5e-13 24.3 70/84  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81440.1 GT:GENE AAQ81440.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(69174..69728) GB:FROM 69174 GB:TO 69728 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81440.1 GB:DB_XREF GI:34732902 LENGTH 184 SQ:AASEQ MNDVIARYSTYLELECACYDFEITDDLVKRIFFNHIYRTTKLPFLRKNSSYIKSVCSQLNYVRRSLLNVKYNRLGKASSIREGYVYVLTNPAWPGHFKIGSTISVYDRLATYQSYSPFRDYKIQTYFFTHDRFKTEKQLHFMFGANGEWVDNTSTQLDDVLRIFNTERNKDRQFLRASLTQLAE GT:EXON 1|1-184:0| HM:PFM:NREP 1 HM:PFM:REP 93->162|PF10544|2.5e-13|24.3|70/84|T5orf172| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1----------------------------------------------------------------------------------------------------------------------------1-------------- DISOP:02AL 1-2,183-185| PSIPRED ccHHHHHHHEEEEEEEEEEEEEEEHHHHHHHHHHHHHcccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccccccEEEEEEccHHHHHHcccccccccccEEEEEEEEEcccHHHHHHHHHHcccccEEEccHHHHHHHHHHHccccHHHHHHHHHHHHHHcc //