[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81441.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:146 amino acids
:PSIPRED
:DISOPRED
:PROS 86->110|PS00212|ALBUMIN_1

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81441.1 GT:GENE AAQ81441.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(70912..71352) GB:FROM 70912 GB:TO 71352 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81441.1 GB:DB_XREF GI:34732903 LENGTH 146 SQ:AASEQ MKKFEHAGKTYEVDDEFTNYAVDADGELWVYSERPSTNVSDRNDYFDAPNSIRQLVDKTSGGLEGPYEIADDSIVTIKVPPELKGFFISMMSCCLEQTLMECYAGHDSQIPGTGLTFEYPHFARCRGEKPDEKCDIVMRLYDNDES GT:EXON 1|1-146:0| PROS 86->110|PS00212|ALBUMIN_1|PDOC00186| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,143-147| PSIPRED cccHHHcccEEEEcccccccEEcccccEEEEEcccccccccccccccccHHHHHHHHHccccccccEEcccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEcccHHHHccccccccccEEEEEEccccc //