[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81442.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:81 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->80 1dq3A PDBj 6e-04 21.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81442.1 GT:GENE AAQ81442.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(71353..71598) GB:FROM 71353 GB:TO 71598 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81442.1 GB:DB_XREF GI:34732904 LENGTH 81 SQ:AASEQ MKTISPTGKEKTFKSWESLREWLDERFDSWDDDILSIPFKSTVYWDLCPYAQDIHNGQENLVWNTDKDELEKQLELIAEEI GT:EXON 1|1-81:0| BL:PDB:NREP 1 BL:PDB:REP 7->80|1dq3A|6e-04|21.1|71/454| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 71 STR:RPRED 87.7 SQ:SECSTR ######EEHHHHHHHHGGGcEEEETTTTEEEEEcTTcccEEEEE###ETTTTEEEEEEEEEEEEEEEcTTccEEEEEETT# DISOP:02AL 1-8| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHcccccEEEccccccEEEEccHHHHHHHccccccEEcccHHHHHHHHHHHHHHc //