[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81443.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:139 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   65->105 PF06856 * DUF1251 3.4e-05 30.8 39/121  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81443.1 GT:GENE AAQ81443.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(71595..72014) GB:FROM 71595 GB:TO 72014 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81443.1 GB:DB_XREF GI:34732905 LENGTH 139 SQ:AASEQ MIYDLCEKGYPFQISMNISGLSDKVNEHTLAVEVLEATQIYYPGSYNNWFRPRGVVALRSIDPDHEFKFVRILIDRDNARTIEAIFSKELNHVDVLNAMVHIAFDYCHDIGHCIAAGFVSDGRYYGRSESIGIDCEGNE GT:EXON 1|1-139:0| HM:PFM:NREP 1 HM:PFM:REP 65->105|PF06856|3.4e-05|30.8|39/121|DUF1251| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 138-140| PSIPRED cccHHHcccccEEEEEEcccccccccccEEEEEEEEEEEEEEccccccccccccEEEEEEccccccEEEEEEEEEccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccccccccccEEEEEcccc //