[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81444.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:70 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   32->61 PF11526 * CFIA_Pcf11 0.00043 26.7 30/85  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81444.1 GT:GENE AAQ81444.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(72027..72239) GB:FROM 72027 GB:TO 72239 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81444.1 GB:DB_XREF GI:34732906 LENGTH 70 SQ:AASEQ MKIYHPQHIAKVNGITKVDMIRGHYRFGISCWIMFKNDQVIDCTFKNDTAQFRSMEKAARQVAAKHQYTL GT:EXON 1|1-70:0| HM:PFM:NREP 1 HM:PFM:REP 32->61|PF11526|0.00043|26.7|30/85|CFIA_Pcf11| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,59-59,67-67,70-71| PSIPRED cccccHHHHHHHcccEEEEEEEEEEEEEEEEEEEEEcccEEEEEEcccHHHHHHHHHHHHHHHHHccccc //