[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81445.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:86 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->62 PF06699 * PIG-F 0.00048 22.4 58/191  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81445.1 GT:GENE AAQ81445.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(72304..72564) GB:FROM 72304 GB:TO 72564 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81445.1 GB:DB_XREF GI:34732907 LENGTH 86 SQ:AASEQ MNLLFELFILSVQYSIIAVMVYVLIHGFAFFDEWRQKRPDYKMPARSLCAVQVYGMIAGAWLPLAIYLVCKLCEFTYIKVTEKIKK GT:EXON 1|1-86:0| TM:NTM 2 TM:REGION 6->28| TM:REGION 51->73| HM:PFM:NREP 1 HM:PFM:REP 4->62|PF06699|0.00048|22.4|58/191|PIG-F| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 85-87| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //