[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81446.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
:165 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 73->149 E136_ARATH 2e-04 34.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81446.1 GT:GENE AAQ81446.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(72564..73061) GB:FROM 72564 GB:TO 73061 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE similar to RB69ORF151c accession NP_861841.1 GB:PROTEIN_ID AAQ81446.1 GB:DB_XREF GI:34732908 LENGTH 165 SQ:AASEQ MQNFKFTPGTIIPAGYVIAIETWENDGDDYKTHFHFGCSEADTTFFALVKPLFESRHSKGNHYGNSSWSESIAVELVEILIDNPGLEPQFKKFLDLSADVYDKETEEFDSGFDIDDLRDNVIDHISNYAVGYGSDFIRVVETIEVYYNPTEYVVPKLPLTFVEAF GT:EXON 1|1-165:0| BL:SWS:NREP 1 BL:SWS:REP 73->149|E136_ARATH|2e-04|34.2|76/477| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,56-63| PSIPRED cccccccccccccccEEEEEEEEEccccccEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccHHHEEEEEEEEcccccccHHHccccHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEEccEEEEEccEEEEEEcc //