[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81480.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:95 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   20->54 PF00754 * F5_F8_type_C 0.00038 25.7 35/129  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81480.1 GT:GENE AAQ81480.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION 106126..106413 GB:FROM 106126 GB:TO 106413 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81480.1 GB:DB_XREF GI:34732943 LENGTH 95 SQ:AASEQ MILIKSSAPVISKTYEAANMSAMTCQLVIDGGDTGKVEIDGSLDGKSWINIAKLSAALNADGIATDGGIASTSWNFYRANLTETSGLATVIVSIS GT:EXON 1|1-95:0| HM:PFM:NREP 1 HM:PFM:REP 20->54|PF00754|0.00038|25.7|35/129|F5_F8_type_C| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,3-7| PSIPRED cEEEEccccccEEEEccccccEEEEEEEEEccccEEEEEEcccccccEEEHHHEEEEcccccEEccccEEccEEEEEEEcccccccEEEEEEEEc //