[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81481.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
:288 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   73->123 PF06121 * DUF959 0.00053 28.6 49/202  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81481.1 GT:GENE AAQ81481.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION 106424..107290 GB:FROM 106424 GB:TO 107290 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81481.1 GB:DB_XREF GI:34732944 LENGTH 288 SQ:AASEQ MILNPKAVLNNTSSGSSGVSSFNGRIGPVDPESGDYTADMVNAIEKAPTDSQRRVLIGTTPTVEELIDPITVVDNLTSDSSTSALSAKQGKLLQDGKQPTITGAASTIASVDLTPVRIAATDSNGKMTTSLVSVSDLDLIKDRTTRVKSELEWTGLNIDVTGTALNLVGALKAITPVYGSWAPMFDIINDKMVAAKNDDRTLLYKIAITGTFDNTSSTNALTLTTTIGSNIDVSSAVRLPNQNPQNINYISLISVDKNGNFATNGASLTLRSTTSDFTITRVRLIAEQ GT:EXON 1|1-288:0| SEG 13->21|ssgssgvss| SEG 74->87|dnltsdsstsalsa| SEG 214->226|ntsstnaltlttt| HM:PFM:NREP 1 HM:PFM:REP 73->123|PF06121|0.00053|28.6|49/202|DUF959| OP:NHOMO 15 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1-1--------11-------1----------------------------111--------------------------------------------------------------------------------------------2--2------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------1------------------------------------------------------------------------------------------------------------------ DISOP:02AL 1-3,83-91,288-289| PSIPRED ccccHHHHHccccccccccccccccccccccccccHHHHHHHHHHcccccccEEEEEcccccHHHHcccEEEEEcccccccccccHHHcccHHHccccccEEccccEEEEEEccEEEEEEEcccccEEEEEEEHHHHHHHHHHHccEEEEEEEEEEEEEEcccHHHHHHHHHHHccccccHHHHHHHcccEEEEEEccccEEEEEEEEEEEccccccccEEEEEEEccccccEEEEEEccccccccEEEEEEEEEEccccEEccccEEEEEEccccEEEEEEEEEEEc //