[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81485.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:102 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   12->70 PF11242 * DUF2774 9e-08 48.3 %
:HMM:PFM   10->73 PF11242 * DUF2774 1.3e-33 44.4 63/63  
:BLT:SWISS 1->101 DBPA_BACSU 6e-04 27.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81485.1 GT:GENE AAQ81485.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(109540..109848) GB:FROM 109540 GB:TO 109848 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81485.1 GB:DB_XREF GI:34732948 LENGTH 102 SQ:AASEQ MRKFTELSNAEKVQIHFMFREMKQGYVQIGRMYDIRAVDVPDIVAYVDGAKLDFETREPVVFRKHYVNPKRGKARPHTDSRFKVTPATGESLEALLNKFNKK GT:EXON 1|1-102:0| BL:SWS:NREP 1 BL:SWS:REP 1->101|DBPA_BACSU|6e-04|27.6|98/479| RP:PFM:NREP 1 RP:PFM:REP 12->70|PF11242|9e-08|48.3|58/63|DUF2774| HM:PFM:NREP 1 HM:PFM:REP 10->73|PF11242|1.3e-33|44.4|63/63|DUF2774| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,4-7,71-77,100-103| PSIPRED cccHHccccccEEEEEEHHHHHHHHHHHHccEEEEEEccccHHEEEEccccccccccccEEEEHHcccHHHcccccccccEEEEcccccHHHHHHHHHHccc //