[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81488.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
:112 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81488.1 GT:GENE AAQ81488.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(110560..110898) GB:FROM 110560 GB:TO 110898 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE similar to RB69ORF040c accession NP_861730.1 GB:PROTEIN_ID AAQ81488.1 GB:DB_XREF GI:34732951 LENGTH 112 SQ:AASEQ MRTIHCKDEYVEFYHGSCTLGLKGDMLLPPEATDTISEKGRKKNLDRVFFTKDRGLAKVYARRAARSIGGEPTLFRVVAPVDTVFMSETPGATVYHAAWAFVEQIPFGKLSD GT:EXON 1|1-112:0| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,111-113| PSIPRED ccEEEccHHEEEEEcccccccccccccccccccccHHHccccccccEEEEEccccHHHHHHHHHHHccccccEEEEEEccEEEEEEccccccEEEEEEHHHHHHcccccccc //