[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81495.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
a.182.1
:156 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  1->127 1ng6A  a.182.1.1 * 3e-04 18.9 %
:HMM:SCOP  1->128 1ng6A_ a.182.1.1 * 4e-09 22.7 %
:HMM:PFM   32->125 PF09424 * YqeY 2.1e-06 29.2 89/143  
:BLT:SWISS 39->127 TTK_MACFA 6e-04 29.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81495.1 GT:GENE AAQ81495.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(115212..115682) GB:FROM 115212 GB:TO 115682 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81495.1 GB:DB_XREF GI:34732958 LENGTH 156 SQ:AASEQ MTLFEQITESRSQARREHGNKAVQLLGLVIGEVNQSRATDDESVRKVILSLMKGINDRIENKYTSEDLVEALKEKEMLSKFLPQEITVDQFNSIVNGKELMDIHRLVGPNINVLAGKLMGRISAGVKDGRWTVAKPKEMKKEIESYVIAALETIGV GT:EXON 1|1-156:0| BL:SWS:NREP 1 BL:SWS:REP 39->127|TTK_MACFA|6e-04|29.5|88/856| HM:PFM:NREP 1 HM:PFM:REP 32->125|PF09424|2.1e-06|29.2|89/143|YqeY| RP:SCP:NREP 1 RP:SCP:REP 1->127|1ng6A|3e-04|18.9|127/148|a.182.1.1| HM:SCP:REP 1->128|1ng6A_|4e-09|22.7|128/148|a.182.1.1|1/1|GatB/YqeY motif| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 11-19| PSIPRED ccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcc //