[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81505.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  5/175   --->[See Alignment]
d.166.1
:639 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   378->548 2c8hA PDBj 8e-22 16.9 %
:RPS:SCOP  383->548 1giqA2  d.166.1.1 * 5e-23 19.4 %
:HMM:SCOP  370->570 1qs1A2 d.166.1.1 * 9.7e-17 26.2 %
:BLT:SWISS 11->637 ALT_BPT4 2e-62 30.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81505.1 GT:GENE AAQ81505.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(124997..126916) GB:FROM 124997 GB:TO 126916 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE similar to alt, T4 accession NP_049811.1 GB:PROTEIN_ID AAQ81505.1 GB:DB_XREF GI:34732968 LENGTH 639 SQ:AASEQ MVIDNAMDGQLNEVFDSAMKFNVANLTPKAKVPHMMAIAAAGKENLVVRFCNYAAKGDAVKQVKPGDKFMQVQIMQMSDKGNLQVLKGGLGSDPIDAMNAICDTTIDVMKLIHADACLIRFPIKQLQGQSKTLARIAERIVNKRGKGMFQYVPGMAKFENKYMYILVARKSKQLADIKGLGIDPELYEIVPAAVGEVVIDKKTGEKVTKVEAVEGTLAAKENKRSPRSVLTGAHLDKKAFLDASRALTSDKFANSLEIHGDRFENPDEITALGGKTSPESEAIGVIVNSPRYGNGDLGQVDLPYEVVKKYEVVNAKNMASLAYDISEYLSPRFDELTNKSESLTREKYIENHMVDMMRAVNDSQRKKMSQVISFADVYNEKHMTNEVSTAVKQYTGVYYEDINDVFVLNMKPGEREERWIKGLDKGFKNIGMKLPEGMSVYRGMKVASELANISLANKMFYFSNYVSCSFTPNIFGSGIGGNKNISKAMISSEETQVAEQKKTFFGFAVHDVQVPVIIPGNTSKHPHENEVILPRGTTFKFTAVSKAEIIDPDYSFSSQTTVWAECIAVSASSLNESDVVYDGDHLMETGELKIIQGFSSFLSESVVADEAQKLNKAQVGRNILASIISDEDMSPKFYN GT:EXON 1|1-639:0| BL:SWS:NREP 1 BL:SWS:REP 11->637|ALT_BPT4|2e-62|30.3|613/682| RP:PDB:NREP 1 RP:PDB:REP 378->548|2c8hA|8e-22|16.9|166/204| RP:SCP:NREP 1 RP:SCP:REP 383->548|1giqA2|5e-23|19.4|160/204|d.166.1.1| HM:SCP:REP 370->570|1qs1A2|9.7e-17|26.2|168/0|d.166.1.1|1/1|ADP-ribosylation| OP:NHOMO 6 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-------------------------------211-1--------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 195 STR:RPRED 30.5 SQ:SECSTR ##################################################################################################################################################################################################################################################################################################################################################################cccccccHHHHHHHHH###HHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHTTTccTTcHHHHHHHHHHTTTTcccccccEEEEEEEcGGGGGcGGGTTTTcccTTccccHHHHHHHHHHHTTcEEEEcccEEEEccccTTTTTccEEEEEEEcTTcccEEcGGGcccccccEEEEcccEEEEEEEEEEcT#Eccc###################################################################################### DISOP:02AL 1-1,126-126,128-129,494-494,608-608,611-616| PSIPRED ccHHHHHHHHHHHHHHccccccEEEccccccccEEEEEEcccccccEEEEEEEccccccccEEccccEEEEEEEEEEcccccEEEEcccccccHHHHHHHHHHHHHHHHHHHcccEEEEEEEccHHccHHHHHHHHHHHHHHccccccEEEEHHHEEEcccEEEEEEEEccccHHHcccccccHHHEEEEEcccccEEEEEccccEEEHHHHHHHHHHHHHHHHccccHHHcccccHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHcccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHcccEEEEEEEEEccccHHHccccccccccEEEEEEccccccEEccccEEEEEEEEcccccEEEccccccccccEEEEEccccEEEEEEEEEEccccccccccccEEEEEEEEEccHHHccHHHHEEcHHHHHHcccEEEEEcHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHcc //