[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81506.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
d.166.1
:319 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   129->293 2c8hB PDBj 5e-18 15.6 %
:RPS:SCOP  130->293 1giqA2  d.166.1.1 * 1e-12 21.6 %
:HMM:SCOP  96->308 1giqA2 d.166.1.1 * 5.4e-26 21.2 %
:BLT:SWISS 130->307 ALT_BPT6 1e-07 26.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81506.1 GT:GENE AAQ81506.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(126948..127907) GB:FROM 126948 GB:TO 127907 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81506.1 GB:DB_XREF GI:34732969 LENGTH 319 SQ:AASEQ MFELDNIIKVEISDCVYQHKKSPSIGKLSEEAEPDYSNFTIDTINQPITLKEFIWAWSKCGSGAWLLGHMPWMNLELGSYEQVRMIFDYHSDSQYHDTCVNIIHSCNRVLEERYSESRSTVGSIEFDDHIHNYCDEGFASVAAGLRSGTFDSGSAGIFAKQCVEVMDRYMDDSIEFRGSVWRGMSMPVASYEQFRNNGSILFKNFVSTSIAPIMYNHGIVECRNLHINKPTAVVRYNPDFPNRQIKINMHIDCSGIKHIVPAKITGYPEECEIILDRNTVIVIDEVFEYLDHPNSSTAKCLIRAKALPLSQFNGPTLVV GT:EXON 1|1-319:0| BL:SWS:NREP 1 BL:SWS:REP 130->307|ALT_BPT6|1e-07|26.6|177/698| RP:PDB:NREP 1 RP:PDB:REP 129->293|2c8hB|5e-18|15.6|160/205| RP:SCP:NREP 1 RP:SCP:REP 130->293|1giqA2|1e-12|21.6|139/204|d.166.1.1| HM:SCP:REP 96->308|1giqA2|5.4e-26|21.2|179/0|d.166.1.1|1/1|ADP-ribosylation| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1-1----------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 176 STR:RPRED 55.2 SQ:SECSTR ###############################################################################################################################HHHHHHHHTHHHHHHHHHHHTTTccTTccHHHHHHHHHHHHHTTccccccEEEEEEEcGGGGcGGHHGTTTcccTTccccHHHHHHHHHHHTTcEEEEcccEEEEcccccGGGTTccEEEEEEEccTTcccEEcTTTcTTccTTEEEEcccEEEEEEEEEEcTTcccEEEEEEEcc################ DISOP:02AL 1-1,24-30| PSIPRED ccccccEEEEEEHHHHHHccccccccccccccccccccEEEEcccccEEHHHHHHHHHccccccHHHHcccccEEEccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccEEcccEEEEcccccHHHHHHHHHccEEEEEEEEccccccEEEcccccccEEEEEcccccEEEEccccccccEEEEEEEEccccccEEEccccccccccEEEcccccEEEEEEEEEEccccccccEEEEEEEEEEEcccccccEEEc //