[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81507.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:88 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   57->71 PF12391 * PCDO_beta_N 0.00032 60.0 15/36  
:HMM:PFM   31->58 PF05595 * DUF771 0.00071 29.6 27/91  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81507.1 GT:GENE AAQ81507.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(127950..128216) GB:FROM 127950 GB:TO 128216 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81507.1 GB:DB_XREF GI:34732970 LENGTH 88 SQ:AASEQ MNLHVRYDGKEFKFVVANDLAAVTAIAHLVKDGFGQAPHHPDGEEWSIFVKPMQVFRDSGWHPAQVYRGYKNGVGCDDYAITVFFRID GT:EXON 1|1-88:0| HM:PFM:NREP 2 HM:PFM:REP 57->71|PF12391|0.00032|60.0|15/36|PCDO_beta_N| HM:PFM:REP 31->58|PF05595|0.00071|29.6|27/91|DUF771| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccEEEEEccEEEEEEEEccHHHHHHHHHHHHHccccccccccccEEEEEEEHHHHHHHccccHHHHHHHHHcccccccEEEEEEEEEc //