[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81514.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
c.1.8
:186 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  41->138 1gvyA  c.1.8.3 * 6e-04 15.9 %
:HMM:PFM   7->68 PF03477 * ATP-cone 0.00011 24.6 61/89  
:BLT:SWISS 8->55 YTMO_BACSU 4e-04 43.5 %
:BLT:SWISS 46->155 FAR1_LOALO 1e-04 30.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81514.1 GT:GENE AAQ81514.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(132531..133091) GB:FROM 132531 GB:TO 133091 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81514.1 GB:DB_XREF GI:34732977 LENGTH 186 SQ:AASEQ MKIQLDTKAIEALFPEGSEARVELQNAVIANFAKKMQEKHLEGVTREQIQKAVRDAGVSMDSYSIVRDMLNKTITNNGWDASNAQLKDTSSLAHAVRNYARQQDLKLMQGMEAWANEMVSKELGKREEAGKHFIEMYISRAETAIAKSKAQALSEIESRLVAACKQNMPEIIRREMANYLNKESQL GT:EXON 1|1-186:0| BL:SWS:NREP 2 BL:SWS:REP 8->55|YTMO_BACSU|4e-04|43.5|46/334| BL:SWS:REP 46->155|FAR1_LOALO|1e-04|30.3|109/178| HM:PFM:NREP 1 HM:PFM:REP 7->68|PF03477|0.00011|24.6|61/89|ATP-cone| RP:SCP:NREP 1 RP:SCP:REP 41->138|1gvyA|6e-04|15.9|88/376|c.1.8.3| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,123-123,125-125,181-187| PSIPRED ccEEEHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcc //