[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81517.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:76 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81517.1 GT:GENE AAQ81517.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(133978..134208) GB:FROM 133978 GB:TO 134208 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81517.1 GB:DB_XREF GI:34732980 LENGTH 76 SQ:AASEQ MTNVSADEMITAQQLIAEKCVLFEEKCKAIDPGVRVEYTPTGFGEFQLTTINSEGTRVDYAFTISIDGQINIARII GT:EXON 1|1-76:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccccHHHHHHHHHHHHHHHHEEHHHcccccccEEEEEccccccEEEEEEEcccccEEEEEEEEEEccEEEEEEEc //