[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81526.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:77 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->47 PF02446 * Glyco_hydro_77 0.00037 22.9 35/503  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81526.1 GT:GENE AAQ81526.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(139578..139811) GB:FROM 139578 GB:TO 139811 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81526.1 GB:DB_XREF GI:34732989 LENGTH 77 SQ:AASEQ MTEINKGLECPFSLAQLKEHYSFWPLTYETYHSIKHDISRLSWYNIEQGFLNGTDDEYACRAYASDLYRLVKYGGPE GT:EXON 1|1-77:0| HM:PFM:NREP 1 HM:PFM:REP 13->47|PF02446|0.00037|22.9|35/503|Glyco_hydro_77| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,76-78| PSIPRED ccccHHcccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccc //