[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81527.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  9/199 : Viruses  1/175   --->[See Alignment]
d.142.2
:366 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  247->360 1s68A  d.142.2.4 * 2e-23 32.7 %
:HMM:SCOP  143->363 1s68A_ d.142.2.4 * 5.1e-07 20.2 %
:RPS:PFM   225->342 PF09414 * RNA_ligase 8e-10 36.4 %
:HMM:PFM   174->356 PF09414 * RNA_ligase 2.3e-36 28.9 166/184  
:BLT:SWISS 41->174 NUDC_DICDI 4e-04 31.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81527.1 GT:GENE AAQ81527.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(139813..140913) GB:FROM 139813 GB:TO 140913 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81527.1 GB:DB_XREF GI:34732990 LENGTH 366 SQ:AASEQ MIINDERQLASMRKIADLQPIPGADAIEVATIDGWEVVVKKGEFRVGSDCVYFEIDSLLPTDHPAFRFLETRAKIYDGKMRARIKTIKLRGQISQGIALPTGAFTVGELLGGQEMDKTIDQMLDIIKYEPPQDGTGCNPGGTFPIFIPKTDEERCQNIFNRYKEKYADVKFAKSLKLDGSSITMAWVTDPELFLDLGTEEEPYAHDYDDAQFIVASRNQVLRYNADSKWWKGVENYQIVDRLKELRMSVAIQGELMGPGIQKNRENFDKYRIFAFRAFFIDEQRFATDEEFQDLCRTLGMEICPQLGYSYPFQEFTNVKDMLAAADIPSIEHKIAEGVVYKSVELVDGRMVHFKAINNKFLLKCED GT:EXON 1|1-366:0| BL:SWS:NREP 1 BL:SWS:REP 41->174|NUDC_DICDI|4e-04|31.0|126/171| RP:PFM:NREP 1 RP:PFM:REP 225->342|PF09414|8e-10|36.4|110/179|RNA_ligase| HM:PFM:NREP 1 HM:PFM:REP 174->356|PF09414|2.3e-36|28.9|166/184|RNA_ligase| GO:PFM:NREP 3 GO:PFM GO:0003972|"GO:RNA ligase (ATP) activity"|PF09414|IPR012647| GO:PFM GO:0005524|"GO:ATP binding"|PF09414|IPR012647| GO:PFM GO:0016874|"GO:ligase activity"|PF09414|IPR012647| RP:SCP:NREP 1 RP:SCP:REP 247->360|1s68A|2e-23|32.7|110/233|d.142.2.4| HM:SCP:REP 143->363|1s68A_|5.1e-07|20.2|198/0|d.142.2.4|1/1|DNA ligase/mRNA capping enzyme, catalytic domain| OP:NHOMO 17 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------1-----------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- ----11--------------------------------------------1-11--2--1-2-----------------------------------------------2----------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,134-140,327-332,365-367| PSIPRED cccccccEEEEEEEEEHcccccccccEEEEEEccEEEEEcccccccccEEEEEccccccccccHHHHccccccccccccccEEEEEEEEccEEEEEEEEcHHHcccccccccccccccHHHHccEEEEEccccccccccccccccccccccHHHcccccccccHHHcccEEEEEEEEccEEEEEEEEcccccccccccccccccccccccEEEEEEccEEccccccccccEEEHHcccHHHHHHHcccEEEEEEEEcccccccccccccccEEEEEEEEEcccccccHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHHccccccccccEEEEEEEcccccccEEEEEEEcHHHHHcccc //