[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81530.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:129 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   26->87 PF01925 * TauE 5.8e-05 17.7 62/239  
:BLT:SWISS 24->87 CRCB_VIBCM 6e-04 36.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81530.1 GT:GENE AAQ81530.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(141368..141757) GB:FROM 141368 GB:TO 141757 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE similar to RB69ORF104c accession NP_861794.1 GB:PROTEIN_ID AAQ81530.1 GB:DB_XREF GI:34732993 LENGTH 129 SQ:AASEQ MKISTKSWHYRLLNTMDMSIPRSLCPYFWKVVFTIGFIGVITTFLAIIFHGVGAKALWNWFDYDANFVYATLFGFTLVVSVLAAVIGVFFGFFYASEKELFTIKTENIVINYIRAKKSKICPTLEFDYE GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 24->87|CRCB_VIBCM|6e-04|36.2|58/126| TM:NTM 2 TM:REGION 29->51| TM:REGION 69->91| HM:PFM:NREP 1 HM:PFM:REP 26->87|PF01925|5.8e-05|17.7|62/239|TauE| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,129-130| PSIPRED cccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccHHHEEHHHccccccccccccc //