[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81543.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:86 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->42 PF04023 * FeoA 0.00058 23.3 30/74  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81543.1 GT:GENE AAQ81543.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(156671..156931) GB:FROM 156671 GB:TO 156931 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81543.1 GB:DB_XREF GI:34733006 LENGTH 86 SQ:AASEQ MQIEIGKKYRVTDAERFMAEHGITNGTEFTVTNIDDDGDLYTYDISWNGRDGKSAFAPSEGWALLLNGRNGNTDEKADYTGSIEEV GT:EXON 1|1-86:0| HM:PFM:NREP 1 HM:PFM:REP 13->42|PF04023|0.00058|23.3|30/74|FeoA| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,85-87| PSIPRED ccEEcccEEEEccHHHHHHHHccccccEEEEEEEcccccEEEEEEEEccccccccccccccEEEEEEccccccccccccccccccc //