[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81545.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:92 amino acids
:PSIPRED
:HMM:PFM   13->40 PF09928 * DUF2160 0.00021 39.3 28/88  
:BLT:SWISS 4->85 SGPP1_HUMAN 3e-04 26.8 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81545.1 GT:GENE AAQ81545.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(157292..157570) GB:FROM 157292 GB:TO 157570 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81545.1 GB:DB_XREF GI:34733008 LENGTH 92 SQ:AASEQ MFEFVISSYWLGVSIAIIFVAISLTLMILTMMNCRAPTQKTIHQIQCWLSLLESGKPLFGKYAVPVTIAFLAITISLLTILWPIVLVYQIVK GT:EXON 1|1-92:0| BL:SWS:NREP 1 BL:SWS:REP 4->85|SGPP1_HUMAN|3e-04|26.8|82/441| TM:NTM 2 TM:REGION 8->30| TM:REGION 62->84| HM:PFM:NREP 1 HM:PFM:REP 13->40|PF09928|0.00021|39.3|28/88|DUF2160| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //