[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81546.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:63 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   3->54 PF05075 * DUF684 0.00016 34.0 47/352  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81546.1 GT:GENE AAQ81546.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(157690..157881) GB:FROM 157690 GB:TO 157881 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81546.1 GB:DB_XREF GI:34733009 LENGTH 63 SQ:AASEQ MNIDAVLTQHIVYGIFAVAGCGLMWQIRKDINQEKRIKRHNQKLEQQARDWMSKNKPQPPNKP GT:EXON 1|1-63:0| HM:PFM:NREP 1 HM:PFM:REP 3->54|PF05075|0.00016|34.0|47/352|DUF684| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,34-64| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccccc //