[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81547.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:110 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   34->69 PF04012 * PspA_IM30 0.00049 22.2 36/221  
:BLT:SWISS 27->100 SECA_NITOC 1e-04 36.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81547.1 GT:GENE AAQ81547.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(157933..158265) GB:FROM 157933 GB:TO 158265 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81547.1 GB:DB_XREF GI:34733010 LENGTH 110 SQ:AASEQ MNDKSWNLIKMFQMKKTKIEPTVTPLPISDLKVEAFELFKKIEERIAHDQTRLEELAKSRENELRRHEAAIRLAMDSHSIKMDDLSLQEALISDSLKGGKYLKNIVAQAC GT:EXON 1|1-110:0| BL:SWS:NREP 1 BL:SWS:REP 27->100|SECA_NITOC|1e-04|36.5|74/903| HM:PFM:NREP 1 HM:PFM:REP 34->69|PF04012|0.00049|22.2|36/221|PspA_IM30| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,54-65| PSIPRED cccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //