[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81549.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:129 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   79->128 PF09278 * MerR-DNA-bind 9.6e-07 35.4 48/65  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81549.1 GT:GENE AAQ81549.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(159484..159873) GB:FROM 159484 GB:TO 159873 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81549.1 GB:DB_XREF GI:34733012 LENGTH 129 SQ:AASEQ MFELYGDVKDFKLFKFKSPEHFVEWLRIKPDVENYYGDMDPEQPFVGSMTIWYGHEEAIFDICDYSGRPPEDDCPTIAFTQDQINEFLDLVSDNPEEECEECRLRLIEDKLIRIEKLQKEVEFLKKQLN GT:EXON 1|1-129:0| SEG 96->106|eeeceecrlrl| HM:PFM:NREP 1 HM:PFM:REP 79->128|PF09278|9.6e-07|35.4|48/65|MerR-DNA-bind| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 129-130| PSIPRED cccccccHHHcEEEEcccHHHHHHHHHccccHHHHHcccccccccccEEEEEEEcHHHHHHHHcccccccccccccEEEEHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //