[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81550.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
a.39.1
:145 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  54->137 1ij5A  a.39.1.9 * 7e-04 14.7 %
:HMM:PFM   109->141 PF10732 * DUF2524 7e-05 39.4 33/84  
:BLT:SWISS 87->144 SYR_METST 3e-04 36.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81550.1 GT:GENE AAQ81550.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(159883..160320) GB:FROM 159883 GB:TO 160320 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81550.1 GB:DB_XREF GI:34733013 LENGTH 145 SQ:AASEQ MIRYFKFKSQTAFNTWKKQWFRRRWSFPSEMEALVDCKPRLCVISPSQRKCVWEILDKDGQAIDTGRIAILENEMHLIELGEIIESDTPEGSAFDTDGYVVSIDNLIESYKEAQANLEEAKLVLMKATDSANPKQLDEIKKVLGH GT:EXON 1|1-145:0| BL:SWS:NREP 1 BL:SWS:REP 87->144|SYR_METST|3e-04|36.5|52/560| HM:PFM:NREP 1 HM:PFM:REP 109->141|PF10732|7e-05|39.4|33/84|DUF2524| RP:SCP:NREP 1 RP:SCP:REP 54->137|1ij5A|7e-04|14.7|75/305|a.39.1.9| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,145-146| PSIPRED ccEEEEEccccHHHHHHHHHHHHHcccHHHHHHHHcccccEEEEcccccHHHHHHHHccccEEcccEEEEEEcccHHHHHHHHHHcccccccccccccEEEEHHHHHHHHHHHHccHHHHEEEEEEEcccccHHHHHHHHHHHcc //