[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81554.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:83 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   31->56 PF03628 * PapG_C 0.00055 37.5 24/108  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81554.1 GT:GENE AAQ81554.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(165213..165464) GB:FROM 165213 GB:TO 165464 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81554.1 GB:DB_XREF GI:34733017 LENGTH 83 SQ:AASEQ MKIQFKSEQAFNEYCDQGGLYPGNAKIVDFMPDGWDSIIIVDRIDVIIHEDNFFWDIAVDPADGMALHTIAYDEVHLFNIIEK GT:EXON 1|1-83:0| SEG 38->48|iiivdridvii| HM:PFM:NREP 1 HM:PFM:REP 31->56|PF03628|0.00055|37.5|24/108|PapG_C| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,6-7| PSIPRED ccEEEccHHHHHHHHHHccccccccEEEEEccccccEEEEEEEEEEEEEcccEEEEEEEcccccEEEEEEEcccEEEHHHHcc //