[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81556.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:192 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   31->108 PF10263 * SprT-like 3e-11 19.2 78/159  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81556.1 GT:GENE AAQ81556.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(165779..166357) GB:FROM 165779 GB:TO 166357 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81556.1 GB:DB_XREF GI:34733019 LENGTH 192 SQ:AASEQ MLSAALKAKIREYYEERVKHIRDNNIVNVTTPTYKLVFTKHKGYVGQCHYAKREIRISELLNRSATWECIKDTINHELAHWATPGHSHDVVWQQMAIRLGAMPQTRVAIGDLQRPFIIECRGEVVGYSDVLRTGEDAAGRYIKRRKRETFGNLVYKPNPDYIDNSNWCEPDVDQKKPVKKTNKIIEDFLSDI GT:EXON 1|1-192:0| HM:PFM:NREP 1 HM:PFM:REP 31->108|PF10263|3e-11|19.2|78/159|SprT-like| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED ccHHHHHHHHHHHHHHHHHHHccccEEEEEccEEEEEEEccccEEEccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccEEEEEccccccEEEEEcccEEcHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHcc //