Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81557.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:89 amino acids
:HMM:PFM   2->45 PF11508 * DUF3218 0.00015 26.2 42/213  
:HMM:PFM   29->78 PF05248 * Adeno_E3A 0.00061 20.0 50/112  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81557.1 GT:GENE AAQ81557.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(166398..166667) GB:FROM 166398 GB:TO 166667 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81557.1 GB:DB_XREF GI:34733020 LENGTH 89 SQ:AASEQ MKITNDKARIQASIDSMISLFAQNWLYEFIKQNQGAKYFDMIKHVREMKLEHTHGITLNLKELGSEGMIYREGRSIFCLKIVYNDKLIE GT:EXON 1|1-89:0| HM:PFM:NREP 2 HM:PFM:REP 2->45|PF11508|0.00015|26.2|42/213|DUF3218| HM:PFM:REP 29->78|PF05248|0.00061|20.0|50/112|Adeno_E3A| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccEEEEHHHccccccEEEcccEEEEEEEEEcccccc //