[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81561.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:86 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   33->57 PF11525 * CopK 0.00021 45.5 22/73  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81561.1 GT:GENE AAQ81561.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(169193..169453) GB:FROM 169193 GB:TO 169453 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81561.1 GB:DB_XREF GI:34733024 LENGTH 86 SQ:AASEQ MFAIQHKESGKCIRSIEYSSSGYIGISFVDCDDMQDGTKVHVFDTIADAKDCMNGKIQVSHDFFEFEVSHYHPDDYQVVCLTATVI GT:EXON 1|1-86:0| SEG 13->27|irsieysssgyigis| HM:PFM:NREP 1 HM:PFM:REP 33->57|PF11525|0.00021|45.5|22/73|CopK| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED cEEEEEcccccEEEEEEEccccEEEEEEEEccccccccEEEEEEEEccHHHccccEEEEEEEEEEEEEEEEccccEEEEEEEEEcc //