[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81563.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:71 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   23->55 PF06881 * Elongin_A 0.00029 18.2 33/109  

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81563.1 GT:GENE AAQ81563.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(169769..169984) GB:FROM 169769 GB:TO 169984 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81563.1 GB:DB_XREF GI:34733026 LENGTH 71 SQ:AASEQ MKLYVLEHIETGKPASFIKDSFDDIVAIDYNEFEPVLAHSSYQDMVAILENNHVFLCSRLNKTKYVVKEIG GT:EXON 1|1-71:0| HM:PFM:NREP 1 HM:PFM:REP 23->55|PF06881|0.00029|18.2|33/109|Elongin_A| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cEEEEEEEEcccccHHHHHHccccEEEEEHHHcccHHHcccHHHHHHHHHccEEEEEEEcccHHHHHHHcc //