[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81565.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
:228 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 101->151 IDI_ECOLU 2e-04 42.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81565.1 GT:GENE AAQ81565.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(170214..170900) GB:FROM 170214 GB:TO 170900 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE similar to RB69ORF132c accession NP_861822.1 GB:PROTEIN_ID AAQ81565.1 GB:DB_XREF GI:34733028 LENGTH 228 SQ:AASEQ MNSSKIFNSQFKLHGKFAESVSNDDIKNETMFFNCDLAFAIMHGGPITRSFIANLPKEWQYDDVVFDSRVHMLMPGWYPAIPGYHHDDVPRPDIPAGQHFITAGQPDYDNPRYRSNHILGLVNADVCPTHFAIGESEFSQIPDGELIYRQWHQEVMAKLGSGELSKHIAPDRTIVEFDWQTWHTGSKSVGTGWRWFGRVSRNTDRVKKITNEIRRNAQVYMEFPMEGW GT:EXON 1|1-228:0| BL:SWS:NREP 1 BL:SWS:REP 101->151|IDI_ECOLU|2e-04|42.0|50/182| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,6-7| PSIPRED ccHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEEEEccccHHHHHHHHccHHcccccEEEEcEEEEEcccccccccccccccccccccccccEEEcccccccccHHHHHHHHHHHccccccccHHccccHHHHHccccHHHHHHHHHHHHHHHHcccHHHHcccccEEEEEEccEEcccccccccccEEEEEEcccHHHHHHHHHHHcccEEEEEEcccccc //