[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : AAQ81568.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:217 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 48->126 ITA6_HUMAN 3e-04 25.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81568.1 GT:GENE AAQ81568.1 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(171447..172100) GB:FROM 171447 GB:TO 172100 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID AAQ81568.1 GB:DB_XREF GI:34733031 LENGTH 217 SQ:AASEQ MIPMAVRERIFTQLRHMQSFTIELIMHQIHSRLAKEPREWTSFFDRRMARIDSTVDYAIKEHAKAGGTLSKAEIAERTGRSLDAELGIAYILGGLTGVMVWLDNDDITFDVPTPDFNLEIKTSFNRWPTMHTAGAEPYGRADGLCLYAGYKGNADVFLVLHMENVDGQTYFNPNYFFTKRAMEKYPYEIATRRMVDGAYINRNHDRYVHFYKKWCTL GT:EXON 1|1-217:0| BL:SWS:NREP 1 BL:SWS:REP 48->126|ITA6_HUMAN|3e-04|25.3|79/1130| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHHHEEEEEEEEcccEEEEcccccccEEEEEcccccccccccccccccccccEEEEEcccccccEEEEEEEEcccccEEEcccHHHHHHHHHHccHHHHHHEEcccHHcccccHHHHHHHHHHHcc //