[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : a-gt.4
DDBJ      :a-gt.4       hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  3/175   --->[See Alignment]
:130 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   35->104 PF10849 * DUF2654 3e-14 66.7 %
:HMM:PFM   35->105 PF10849 * DUF2654 4.1e-35 62.9 70/70  
:BLT:SWISS 11->104 Y03H_BPT4 3e-10 35.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81364.1 GT:GENE a-gt.4 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(28879..29271) GB:FROM 28879 GB:TO 29271 GB:DIRECTION - GB:GENE a-gt.4 GB:PRODUCT hypothetical protein GB:NOTE similar to T4 accession NP_049677.1 GB:PROTEIN_ID AAQ81364.1 GB:DB_XREF GI:34732826 GB:GENE:GENE a-gt.4 LENGTH 130 SQ:AASEQ MSPDYEVDLSTGEEELSSSFDQELLEMQDRIEKQAEKQAAKHLKTHGREIKRLKKHAERALFANNKEQYVYAIDKLRTLYKQKLLPKHAMITMFETSRAQIVDMAKSLSTAPTIQSDVEYHQQTVPVCSL GT:EXON 1|1-130:0| BL:SWS:NREP 1 BL:SWS:REP 11->104|Y03H_BPT4|3e-10|35.5|93/105| RP:PFM:NREP 1 RP:PFM:REP 35->104|PF10849|3e-14|66.7|69/70|DUF2654| HM:PFM:NREP 1 HM:PFM:REP 35->105|PF10849|4.1e-35|62.9|70/70|DUF2654| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------1---------------11------------------------------------------------------------------------------------------------------------------------------------------ DISOP:02AL 1-3,29-46,110-121| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccc //