[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : a-gt.5
DDBJ      :a-gt.5       hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:74 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81365.1 GT:GENE a-gt.5 GT:PRODUCT hypothetical protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(29261..29485) GB:FROM 29261 GB:TO 29485 GB:DIRECTION - GB:GENE a-gt.5 GB:PRODUCT hypothetical protein GB:NOTE similar to T4 accession NP_049678.1 GB:PROTEIN_ID AAQ81365.1 GB:DB_XREF GI:34732827 GB:GENE:GENE a-gt.5 LENGTH 74 SQ:AASEQ MKTNLKLDLESLFDSVCGEVDLMSYFVKLQMRDYKIPVEINPMNISWQPFEVTSGQLDWHIDAETMTMEIEYVA GT:EXON 1|1-74:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccEEEEEHHHHHHHHcccEEHHHHHHHHHHHHccccEEEEcccccccccEEEEEEEEEEEcccEEEEEEEEEc //