[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : asiA
DDBJ      :asiA         anti-sigma 70 protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  5/175   --->[See Alignment]
a.150.1
:90 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->89 1ka3A PDBj 1e-13 36.9 %
:RPS:SCOP  5->89 1jr5A  a.150.1.1 * 6e-26 36.9 %
:HMM:SCOP  1->90 1jr5A_ a.150.1.1 * 1.2e-36 59.6 %
:RPS:PFM   5->90 PF09010 * AsiA 2e-22 61.6 %
:HMM:PFM   1->90 PF09010 * AsiA 1.9e-47 60.0 90/91  
:BLT:SWISS 5->89 ASIA_BPT4 3e-13 36.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81544.1 GT:GENE asiA GT:PRODUCT anti-sigma 70 protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(156941..157213) GB:FROM 156941 GB:TO 157213 GB:DIRECTION - GB:GENE asiA GB:PRODUCT anti-sigma 70 protein GB:FUNCTION activation of phage middle promoters GB:NOTE binds RNAP sigma 70 subunit, functions in conjunction with MotA; similar to T4 accession NP_049866.1; AsiA GB:PROTEIN_ID AAQ81544.1 GB:DB_XREF GI:34733007 GB:GENE:GENE asiA LENGTH 90 SQ:AASEQ MNYSENIKDIIATASLLIKFGCEDILNKQETFVSFLNELGFRSPTGEEFTRAGFRQMMKRLPIEQREELIEMFNQGHRDVNHQMMMYSNN GT:EXON 1|1-90:0| BL:SWS:NREP 1 BL:SWS:REP 5->89|ASIA_BPT4|3e-13|36.9|84/90| BL:PDB:NREP 1 BL:PDB:REP 5->89|1ka3A|1e-13|36.9|84/89| RP:PFM:NREP 1 RP:PFM:REP 5->90|PF09010|2e-22|61.6|86/91|AsiA| HM:PFM:NREP 1 HM:PFM:REP 1->90|PF09010|1.9e-47|60.0|90/91|AsiA| RP:SCP:NREP 1 RP:SCP:REP 5->89|1jr5A|6e-26|36.9|84/90|a.150.1.1| HM:SCP:REP 1->90|1jr5A_|1.2e-36|59.6|89/90|a.150.1.1|1/1|Anti-sigma factor AsiA| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1---------------1---------------11--1--------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 93.3 SQ:SECSTR ####HHHHHHHHHHHHHHHHTTGGGGGcHHHHHHHHHHHTc#TTTTcccccHHHHHHHTTccHHHHHHHHHHccHHHHHHHHHHHHTTc# DISOP:02AL 1-3,89-91| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcc //