[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : cd
DDBJ      :cd           dCMP deaminase
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  281/915 : Eukaryota  143/199 : Viruses  10/175   --->[See Alignment]
c.97.1
:172 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->164 1vq2A PDBj 7e-56 65.2 %
:RPS:PDB   7->165 2b3jD PDBj 4e-18 29.8 %
:RPS:SCOP  1->154 1vq2A  c.97.1.2 * 2e-30 66.0 %
:HMM:SCOP  1->172 1vq2A_ c.97.1.2 * 1.4e-36 34.1 %
:RPS:PFM   19->132 PF00383 * dCMP_cyt_deam_1 3e-14 51.2 %
:HMM:PFM   3->131 PF00383 * dCMP_cyt_deam_1 2.3e-34 56.8 95/102  
:BLT:SWISS 1->154 DCTD_BPT2 6e-53 67.3 %
:PROS 85->120|PS00903|CYT_DCMP_DEAMINASES

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81516.1 GT:GENE cd GT:PRODUCT dCMP deaminase GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(133460..133978) GB:FROM 133460 GB:TO 133978 GB:DIRECTION - GB:GENE cd GB:PRODUCT dCMP deaminase GB:NOTE allosteric enzyme activated by HM-dCTP and dCTP for dUMP synthesis; similar to T4 accession NP_049828.1; Cd GB:PROTEIN_ID AAQ81516.1 GB:DB_XREF GI:34732979 GB:GENE:GENE cd LENGTH 172 SQ:AASEQ MKVSSVLQHAYIVAQESHCVSWKVGAIITKDGRIISTGYNGTPAGGHENCDDHAKAAGWLDPETGKLKAMYRQAHNEWSSCNEIHAELNAILYAAKSGQSIDGAEMYVTVSPCRECAKAIAQSGIKKVFYNELYDRNTPGWDEILVKSGIKVIHNKVPLNLLKKEFTVSNQN GT:EXON 1|1-172:0| BL:SWS:NREP 1 BL:SWS:REP 1->154|DCTD_BPT2|6e-53|67.3|153/188| PROS 85->120|PS00903|CYT_DCMP_DEAMINASES|PDOC00702| BL:PDB:NREP 1 BL:PDB:REP 1->164|1vq2A|7e-56|65.2|161/173| RP:PDB:NREP 1 RP:PDB:REP 7->165|2b3jD|4e-18|29.8|124/150| RP:PFM:NREP 1 RP:PFM:REP 19->132|PF00383|3e-14|51.2|80/100|dCMP_cyt_deam_1| HM:PFM:NREP 1 HM:PFM:REP 3->131|PF00383|2.3e-34|56.8|95/102|dCMP_cyt_deam_1| GO:PFM:NREP 2 GO:PFM GO:0008270|"GO:zinc ion binding"|PF00383|IPR002125| GO:PFM GO:0016787|"GO:hydrolase activity"|PF00383|IPR002125| RP:SCP:NREP 1 RP:SCP:REP 1->154|1vq2A|2e-30|66.0|153/173|c.97.1.2| HM:SCP:REP 1->172|1vq2A_|1.4e-36|34.1|167/0|c.97.1.2|1/1|Cytidine deaminase-like| OP:NHOMO 485 OP:NHOMOORG 452 OP:PATTERN -----------------------1------------------------11211-1111111111--11 ---------------------------------------------------------------1---------------1111-----1111-1111--111111-11-1---------------11111111111-----111----1-111-----------------1-------------------1111111111111111111111111111111111-111111-1111111111111111111111111-11111111111111111-111111111111111111111111111111111111111111111111111-----------12111111--11111111111111-1111111-11-----------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------1111111111111-111111111111111121-------------------1----------------------111----1-11-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111----------------1---------------111----1--11-1-----11-------1111111111-1- --11--1-----1111111-111---111-111-11-11---111111111111---1----11-111111--111111111111111-1211--111111---1--1--212111-1111-1122-1-342-122111-21-11-1-1-1--1-11112311111-211-11111--191111111121111111111 ---1---------------1---------------111-1--------------------------------------------------1-----1-----------------1---------------------------------------------------------1-- STR:NPRED 166 STR:RPRED 96.5 SQ:SECSTR ccHHHEHHHHHHHHHHHHTTTcccEEEEEETTEEEEEEEccHHHHTcGccTTcHHHHGcccTTHHHHHHHHHHEETTccGGTTccHHHHHHHHHHHTccccTTcEEEEEEcccHHHHHHHHHHTccEEEEEEccTcTcTTcccGGGcTTcccGccEEEccTTHHHH###### DISOP:02AL 1-1,172-173| PSIPRED ccHHHHHHHHHHHHHHHccccccEEEEEEEccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHccccEEEEEccccccccHHHHHHHHcccEEEEEHHHHHHHHHHHHHHccc //