[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : denV
DDBJ      :denV         endonuclease V
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  4/175   --->[See Alignment]
a.18.1
:152 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->129 2endA PDBj 7e-15 39.0 %
:RPS:SCOP  2->126 1eniA  a.18.1.1 * 9e-05 37.2 %
:HMM:SCOP  2->142 2endA_ a.18.1.1 * 6.9e-51 46.5 %
:RPS:PFM   1->129 PF03013 * Pyr_excise 2e-19 51.4 %
:HMM:PFM   1->134 PF03013 * Pyr_excise 4.5e-50 53.2 124/130  
:BLT:SWISS 1->129 END5_BPT4 5e-15 39.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81348.1 GT:GENE denV GT:PRODUCT endonuclease V GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(15738..16196) GB:FROM 15738 GB:TO 16196 GB:DIRECTION - GB:GENE denV GB:PRODUCT endonuclease V GB:FUNCTION repair of pyrimidine dimers GB:NOTE bifunctional; similar to T4 accession NP_049733.1; N-glycosylase UV repair enzyme; DenV GB:PROTEIN_ID AAQ81348.1 GB:DB_XREF GI:34732810 GB:GENE:GENE denV LENGTH 152 SQ:AASEQ MTRINLEHPSLLCNAHLVGEWYENPRVASILIKKNGRTGKIPKRFTVRTNKNPDGGRGHVTFFYNKLAWLRDRYLMLMDEMTKRGYSPTDNWKVEIFFPEYTHLFGEWTPTEADISLSRTRIAEMIPEKHKLTNEQLEKLSAIAEYEAFNEK GT:EXON 1|1-152:0| BL:SWS:NREP 1 BL:SWS:REP 1->129|END5_BPT4|5e-15|39.5|124/138| BL:PDB:NREP 1 BL:PDB:REP 2->129|2endA|7e-15|39.0|123/137| RP:PFM:NREP 1 RP:PFM:REP 1->129|PF03013|2e-19|51.4|111/121|Pyr_excise| HM:PFM:NREP 1 HM:PFM:REP 1->134|PF03013|4.5e-50|53.2|124/130|Pyr_excise| RP:SCP:NREP 1 RP:SCP:REP 2->126|1eniA|9e-05|37.2|121/137|a.18.1.1| HM:SCP:REP 2->142|2endA_|6.9e-51|46.5|129/137|a.18.1.1|1/1|T4 endonuclease V| OP:NHOMO 24 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----1--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111------------------------1--------------------------------------------------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-------1------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1---1-----------------------------------------------------------------------------------------------------------------------------------11-- STR:NPRED 123 STR:RPRED 80.9 SQ:SECSTR #cccccccGGGccHHHHHHHHHHTTHHHHH#HHHHHHTTccGGGccccccccc##cTTTTGGGTTcHHHHHHHHHHHHHHHHHTTcccccccccccTccG##GGcccccccHHHHHHHHHHHHHHHHHc####################### DISOP:02AL 151-153| PSIPRED ccccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccccccEEEHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccc //