[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : hoc
DDBJ      :hoc          head outer capsid protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
:180 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->68 PF00801 * PKD 3.3e-05 31.5 54/69  
:BLT:SWISS 5->171 HOC_BPT4 1e-10 38.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81490.1 GT:GENE hoc GT:PRODUCT head outer capsid protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(111906..112448) GB:FROM 111906 GB:TO 112448 GB:DIRECTION - GB:GENE hoc GB:PRODUCT head outer capsid protein GB:NOTE highly immunogenic supplemental capsid protein at the center of each capsomere; similar to T4 accession NP_049793.1; T4 gene synonym: eph; Hoc GB:PROTEIN_ID AAQ81490.1 GB:DB_XREF GI:34732953 GB:GENE:GENE hoc LENGTH 180 SQ:AASEQ MAITLTVAPLSQTVAVGTDVEFTATFTGDDTVKEIVSYAWLLNDSVLSGETSDTIAELFDTEGDFEVKCRVVYALVADDGAAPVTITSTASTITVEEIPVIPEGHWFVNPLEFKNSSFTWLPYWIHDWMKANPAWRDDPVNSPWPKVTYAIDKAVTDYGDCLMQESRNGYIYKASQFVKS GT:EXON 1|1-180:0| BL:SWS:NREP 1 BL:SWS:REP 5->171|HOC_BPT4|1e-10|38.3|162/376| SEG 81->98|aapvtitstastitveei| HM:PFM:NREP 1 HM:PFM:REP 9->68|PF00801|3.3e-05|31.5|54/69|PKD| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,179-181| PSIPRED cccEEEEccccEEEEccccEEEEEEEEcccccccEEEEEEEEcccccccccccEEEEEEccccccEEEEEEEEEEEEccccccEEEEccccEEEEHHccccccccEEEcccccccccEEEEcHHHHHHHHccccccccccccccHHHHHHHHHHHHHccccEEEEccccEEEEHHHHHcc //