[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : motA
DDBJ      :motA         binds Mot boxes at phage middle promoters
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  3/175   --->[See Alignment]
a.4.5d.199.1
:217 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->88 1i1sA PDBj 2e-12 42.4 %
:BLT:PDB   132->212 1kafE PDBj 4e-16 47.5 %
:RPS:PDB   7->92 3bddB PDBj 5e-07 15.1 %
:RPS:SCOP  1->91 1u2wA1  a.4.5.5 * 2e-08 12.2 %
:RPS:SCOP  110->212 1kafA  d.199.1.1 * 9e-29 43.1 %
:HMM:SCOP  4->98 1bjaA_ a.4.5.9 * 1e-27 47.3 %
:HMM:SCOP  109->215 1kafA_ d.199.1.1 * 2.1e-46 60.4 %
:RPS:PFM   4->88 PF09114 * MotA_activ 3e-15 60.7 %
:RPS:PFM   111->209 PF09158 * MotCF 2e-23 63.3 %
:HMM:PFM   111->212 PF09158 * MotCF 1.1e-48 68.3 101/103  
:HMM:PFM   4->98 PF09114 * MotA_activ 3.5e-46 55.3 94/96  
:BLT:SWISS 3->212 MOTA_BPT4 2e-31 40.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81553.1 GT:GENE motA GT:PRODUCT binds Mot boxes at phage middle promoters GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(164469..165122) GB:FROM 164469 GB:TO 165122 GB:DIRECTION - GB:GENE motA GB:PRODUCT binds Mot boxes at phage middle promoters GB:FUNCTION activator of middle period transcription GB:NOTE acts with AsiA; similar to T4 accession NP_049873.1; T4 gene synonym: sip; MotA GB:PROTEIN_ID AAQ81553.1 GB:DB_XREF GI:34733016 GB:GENE:GENE motA LENGTH 217 SQ:AASEQ MTMTKIEAIAKVLNNASISDNATQIFIQVAKKAFITVSEIAESVEMNKNAVYSNIGVMIKKELIEKSGDGYITTEAGDAILVEAAEMWKAAQPVEEVKVEKKKGTRKSREITAEMTGLMEKISALVEENIGLKAVEIYRQNYQIIFSKRTAEGYRKFEVLNNGKFRIFGYKVAEDKLEAFRQVGAEIKVGGSNTYIDIEQNEVNIAKVMQIAVGFSI GT:EXON 1|1-217:0| BL:SWS:NREP 1 BL:SWS:REP 3->212|MOTA_BPT4|2e-31|40.0|205/211| SEG 94->103|veevkvekkk| BL:PDB:NREP 2 BL:PDB:REP 3->88|1i1sA|2e-12|42.4|85/96| BL:PDB:REP 132->212|1kafE|4e-16|47.5|80/103| RP:PDB:NREP 1 RP:PDB:REP 7->92|3bddB|5e-07|15.1|86/131| RP:PFM:NREP 2 RP:PFM:REP 4->88|PF09114|3e-15|60.7|84/96|MotA_activ| RP:PFM:REP 111->209|PF09158|2e-23|63.3|98/103|MotCF| HM:PFM:NREP 2 HM:PFM:REP 111->212|PF09158|1.1e-48|68.3|101/103|MotCF| HM:PFM:REP 4->98|PF09114|3.5e-46|55.3|94/96|MotA_activ| RP:SCP:NREP 2 RP:SCP:REP 1->91|1u2wA1|2e-08|12.2|90/104|a.4.5.5| RP:SCP:REP 110->212|1kafA|9e-29|43.1|102/108|d.199.1.1| HM:SCP:REP 4->98|1bjaA_|1e-27|47.3|91/0|a.4.5.9|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 109->215|1kafA_|2.1e-46|60.4|106/108|d.199.1.1|1/1|DNA-binding C-terminal domain of the transcription factor MotA| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---1-------------------------------1---1--------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 211 STR:RPRED 97.2 SQ:SECSTR HHGGGGHHHHHHHHHHcccHHHHHHHHHHHHcccEEHHHHHHHHTccHHHHHHHHHHHHHTTcEEEcccEEEEcHHHHHHHTTcccHHHHHHHHHHHHHTTTccHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEcccEEEEEEEEEE#TTEEEEEEETTcEEEEEEEcccHHHHHHHHTTTcEEEEcTcEEEEEEEccHHHHHHHHHHH##### DISOP:02AL 1-3,97-112| PSIPRED ccHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHccccEEcccHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHHHHcHHHHHHHHHHHccHHHHcccHHHHHHHHHHHHHHHHccEEEEEHHccHHHHHHHHHHHHccHHEEEEcccccEEEEEEEHHHHHHHHHHHcccEEEEcccEEEEEEEccHHHHHHHHHHHHcccc //