[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Bacteriophage 44RR2.8t (bp441)
Gene : ndd
DDBJ      :ndd          nucleoid disruption protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  1/175   --->[See Alignment]
:145 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   6->143 PF06591 * Phage_T4_Ndd 2e-13 37.8 %
:HMM:PFM   6->140 PF06591 * Phage_T4_Ndd 6.9e-09 27.3 132/152  
:BLT:SWISS 6->143 NDD_BPR70 3e-06 27.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD DDBJ Abbreviations Back to title page
GT:ID AAQ81560.1 GT:GENE ndd GT:PRODUCT nucleoid disruption protein GT:DATABASE AY375531 GT:ORG bp441 GB:ACCESSION AY375531 GB:LOCATION complement(168742..169179) GB:FROM 168742 GB:TO 169179 GB:DIRECTION - GB:GENE ndd GB:PRODUCT nucleoid disruption protein GB:FUNCTION binds host HU protein and host DNA to the membrane prior to degradation GB:NOTE similar to T4 accession NP_049879.1; T4 gene synonym: D2b; Ndd GB:PROTEIN_ID AAQ81560.1 GB:DB_XREF GI:34733023 GB:GENE:GENE ndd LENGTH 145 SQ:AASEQ MSKQNLNVQRIISAGAQRLGHFENGNFKFVTGKSKDDARGKGFYFIVSAGVVKARTFVGDQETNRGFNETIYRVCHGFQPLTDEIWSKSYSLNQVVYFMPLHLVPSLLKSPAQLELFGENMAKAQTLTTVSRQLFKVYNFEYQKR GT:EXON 1|1-145:0| BL:SWS:NREP 1 BL:SWS:REP 6->143|NDD_BPR70|3e-06|27.4|135/147| RP:PFM:NREP 1 RP:PFM:REP 6->143|PF06591|2e-13|37.8|135/148|Phage_T4_Ndd| HM:PFM:NREP 1 HM:PFM:REP 6->140|PF06591|6.9e-09|27.3|132/152|Phage_T4_Ndd| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-8,144-146| PSIPRED cccccccHHHHHHHHHHHccccccccEEEEEcccccccccccEEEEEEcccEEHHHHcccHHccccHHHHHHHHHccccccHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHccc //